PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000133542
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 363aa    MW: 40679.2 Da    PI: 5.0738
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000133542genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.83.4e-151764148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++ Ed++l+  +++ G ++W++ +++ g+ R++k+c++rw +yl
    MDP0000133542 17 RGPWSPAEDLRLITFIQKNGHDNWRALPKRAGLLRCGKSCRLRWINYL 64
                     89******************************99************97 PP

2Myb_DNA-binding50.35.4e-1670115148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T eE+e ++++++ lG++ W++Ia++++ gRt++++k+ w+++l
    MDP0000133542  70 RGNFTIEEEESIIRLHEALGNK-WSKIAAHFP-GRTDNEIKNVWNTHL 115
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.3E-22867IPR009057Homeodomain-like
PROSITE profilePS5129414.8591264IPR017930Myb domain
SuperFamilySSF466896.11E-2915111IPR009057Homeodomain-like
SMARTSM007173.6E-121666IPR001005SANT/Myb domain
PfamPF002492.2E-141764IPR001005SANT/Myb domain
CDDcd001673.94E-91964No hitNo description
PROSITE profilePS5129424.84465119IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-2668120IPR009057Homeodomain-like
SMARTSM007173.8E-1369117IPR001005SANT/Myb domain
PfamPF002491.2E-1470115IPR001005SANT/Myb domain
CDDcd001671.24E-972115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009809Biological Processlignin biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MGGKGRSPCC DKEKVKRGPW SPAEDLRLIT FIQKNGHDNW RALPKRAGLL RCGKSCRLRW  60
INYLRPDVKR GNFTIEEEES IIRLHEALGN KWSKIAAHFP GRTDNEIKNV WNTHLKKRLK  120
RQNLPSSSSS SSSTTTTLLS GGKPSVGGGE ELIEHQSAEE TSMATXNKPH EPCSLTIQEN  180
PNHHDSPMEL TNDPKELTGL TTSSSNXSSN ESNGSSSSSQ VVGMSRPGAE EQQMDDSNYF  240
SGIFDFPFES DSYFWDMFND FEPLQSNLVQ VLHXADEANC QRSGLGQVEN GKWLSYLESE  300
LGLEVTPTES EKNNQEILPK YATEQPIFPE AFDKLPNPTE ADESMDYFNS NVAFATQQFL  360
HSN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C6e-25171194105C-Myb DNA-Binding Domain
1msf_C6e-25171194105C-Myb DNA-Binding Domain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1140148GGKPSVGGG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00144DAPTransfer from AT1G16490Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008372170.10.0PREDICTED: myb-related protein Myb4-like
TrEMBLM5WMX01e-115M5WMX0_PRUPE; Uncharacterized protein
STRINGPOPTR_0005s09930.15e-84(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF100293042
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G16490.16e-71myb domain protein 58